(data stored in ACNUC7421 zone)

EMBL: CP000271.PE304

CP000271.PE304       Location/Qualifiers
FT   CDS             complement(352939..353580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2721"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2721"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33272"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL7"
FT                   /protein_id="ABE33272.1"
FT                   /translation="MSASASEISMSAIPSNPSTRQLVHTRRVECMGFKRRDGLFDIEGH
FT                   IRDTKADDSDLLFKTVPAGSPIHDMRIVVTIDSELLIHRIEAHTDSSPSRFCTEINEAY
FT                   AGLEGMTIGAGFMKEVKSRLSGPKGCTHLTELLGPIATTAIQTLMGWRKAAPAGRDSGE
FT                   ATGSAQAHPMVDTCYAWRAGGDVVQFVARRKQESVRGEAQTAGATPPPDQ"
     MSASASEISM SAIPSNPSTR QLVHTRRVEC MGFKRRDGLF DIEGHIRDTK ADDSDLLFKT        60
     VPAGSPIHDM RIVVTIDSEL LIHRIEAHTD SSPSRFCTEI NEAYAGLEGM TIGAGFMKEV       120
     KSRLSGPKGC THLTELLGPI ATTAIQTLMG WRKAAPAGRD SGEATGSAQA HPMVDTCYAW       180
     RAGGDVVQFV ARRKQESVRG EAQTAGATPP PDQ                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page