(data stored in ACNUC7421 zone)

EMBL: CP000271.PE306

CP000271.PE306       Location/Qualifiers
FT   CDS             355198..355548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2719"
FT                   /product="Putative phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2719"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33274"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL5"
FT                   /protein_id="ABE33274.1"
FT                   /translation="MNQNKVFTLAGGVLLVLASFNVYAQGSDAAPASGHAYAPDAKAIK
FT                   AADRALQKNVVRALSRTKGLRAATITVRAHNGAVILEGTVPEQAQVGLATQAAEGVEGV
FT                   TSVTNALTLSTL"
     MNQNKVFTLA GGVLLVLASF NVYAQGSDAA PASGHAYAPD AKAIKAADRA LQKNVVRALS        60
     RTKGLRAATI TVRAHNGAVI LEGTVPEQAQ VGLATQAAEG VEGVTSVTNA LTLSTL           116
//

If you have problems or comments...

PBIL Back to PBIL home page