(data stored in SCRATCH zone)

EMBL: CP000271.PE312

CP000271.PE312       Location/Qualifiers
FT   CDS             complement(363836..365875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2713"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33280"
FT                   /db_xref="GOA:Q13RK9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK9"
FT                   /protein_id="ABE33280.1"
FT                   /translation="MMSRGIGLVTVLLAISVGLAACDGDSGGPTASQAANVSTSGLAPA
FT                   NAAPASNDNASIDAATTTPLPCDAAATANTPCSAAHSVTRLLTRNYRGPLFQVQRASDN
FT                   AKQDIYPYTSSTLPHGADRSLIGSANVKSANTFCNNTTCSVTYIYDQIDLVAPLKGGAF
FT                   GNVPATLTLNPDGTESLTVPNSGSRPQKTTTVPVLNGFATITLPGTSGALAVQLSQPPT
FT                   ALTAQSPTLQLSIGNDLPALSGTPAKLGFVPLQGAQIPALGTLAGQAYRNRFGTVNQSI
FT                   GDSDIAEYMVAGAHYSQSSTCCGTYGNMENSANPGTYAHGEIEGEMFALAFSNGNAAVF
FT                   GYCDGNSNQPPNVKDPVCNARDTNWPGVDAEAGVYLYGPPQPAREKFVTVLSKYSPVTA
FT                   SNIFAVKGGSASQSVLTALYDQAPPEAYNFGNDAGHAFNGQWQGGLSLGEGGDGSAAPI
FT                   QFFEGAVITKATSDTTDNAIQASIASFYGPPADKAVAACYANNLINSPLSLATPDIWSQ
FT                   QNGGTAVPATDISGVNRGAATVTSTNGSSVSNVREIIRVQGGQSYSFTDYVLATSNATV
FT                   FPGGSIQTDDPSGTEFAWVLNTNTGAVVRGTWGAGQPTALSAVRSGNWWKVTMTLTAPA
FT                   GSNNASVFIDPPTSNAAGARSQQASYLSATHYCPSLAIVASSGT"
     MMSRGIGLVT VLLAISVGLA ACDGDSGGPT ASQAANVSTS GLAPANAAPA SNDNASIDAA        60
     TTTPLPCDAA ATANTPCSAA HSVTRLLTRN YRGPLFQVQR ASDNAKQDIY PYTSSTLPHG       120
     ADRSLIGSAN VKSANTFCNN TTCSVTYIYD QIDLVAPLKG GAFGNVPATL TLNPDGTESL       180
     TVPNSGSRPQ KTTTVPVLNG FATITLPGTS GALAVQLSQP PTALTAQSPT LQLSIGNDLP       240
     ALSGTPAKLG FVPLQGAQIP ALGTLAGQAY RNRFGTVNQS IGDSDIAEYM VAGAHYSQSS       300
     TCCGTYGNME NSANPGTYAH GEIEGEMFAL AFSNGNAAVF GYCDGNSNQP PNVKDPVCNA       360
     RDTNWPGVDA EAGVYLYGPP QPAREKFVTV LSKYSPVTAS NIFAVKGGSA SQSVLTALYD       420
     QAPPEAYNFG NDAGHAFNGQ WQGGLSLGEG GDGSAAPIQF FEGAVITKAT SDTTDNAIQA       480
     SIASFYGPPA DKAVAACYAN NLINSPLSLA TPDIWSQQNG GTAVPATDIS GVNRGAATVT       540
     STNGSSVSNV REIIRVQGGQ SYSFTDYVLA TSNATVFPGG SIQTDDPSGT EFAWVLNTNT       600
     GAVVRGTWGA GQPTALSAVR SGNWWKVTMT LTAPAGSNNA SVFIDPPTSN AAGARSQQAS       660
     YLSATHYCPS LAIVASSGT                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page