(data stored in SCRATCH zone)

EMBL: CP000271.PE313

CP000271.PE313       Location/Qualifiers
FT   CDS             complement(366562..367944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2712"
FT                   /product="putative TRAP-type uncharacterized transport
FT                   system periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2712"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33281"
FT                   /db_xref="GOA:Q13RK8"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK8"
FT                   /protein_id="ABE33281.1"
FT                   /translation="MPPVRSTDQRDQTVPRHNPVLQRARKAPVKPRRPWLFITGAILLL
FT                   AVSGWVLAIILAPAFQHTIVVTSGADGGIYRGFADRYAPILKQKGITLDIRSSSGSVEN
FT                   YQRLKDPRSEYQVGFIQSGTTRPKETDDLKTIAAVSYEPIWVFYRGDTTIDRLAQLRGE
FT                   RISIGVPGSGLLNVALQLLAYSGVSGDNTTLLQMDAAKAYQSLENGQLDAAFFIGRPDA
FT                   EMQRTLLNSNLKLMSFAQADALVQKFPSLSKVIFPRGSTSIANDRPSADVTLLAATALL
FT                   VAKESLHPAFVYLLLDAASAVHGREDYFTPLGKFPNVNTDEFPVSDESIRYFKSGRPFL
FT                   QRYLPFWLASFVERRLLILLPFAALLLGVLQALPRIAETRIKNRLVVWYREVKLLEDEI
FT                   WRSDRPGREQISQWSEEIEQIDAHANQIRLPQRYLPDIYALKQAIDVVRGRISYMARQT
FT                   EK"
     MPPVRSTDQR DQTVPRHNPV LQRARKAPVK PRRPWLFITG AILLLAVSGW VLAIILAPAF        60
     QHTIVVTSGA DGGIYRGFAD RYAPILKQKG ITLDIRSSSG SVENYQRLKD PRSEYQVGFI       120
     QSGTTRPKET DDLKTIAAVS YEPIWVFYRG DTTIDRLAQL RGERISIGVP GSGLLNVALQ       180
     LLAYSGVSGD NTTLLQMDAA KAYQSLENGQ LDAAFFIGRP DAEMQRTLLN SNLKLMSFAQ       240
     ADALVQKFPS LSKVIFPRGS TSIANDRPSA DVTLLAATAL LVAKESLHPA FVYLLLDAAS       300
     AVHGREDYFT PLGKFPNVNT DEFPVSDESI RYFKSGRPFL QRYLPFWLAS FVERRLLILL       360
     PFAALLLGVL QALPRIAETR IKNRLVVWYR EVKLLEDEIW RSDRPGREQI SQWSEEIEQI       420
     DAHANQIRLP QRYLPDIYAL KQAIDVVRGR ISYMARQTEK                             460
//

If you have problems or comments...

PBIL Back to PBIL home page