(data stored in ACNUC7421 zone)

EMBL: CP000271.PE316

CP000271.PE316       Location/Qualifiers
FT   CDS             complement(369471..370643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2709"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Endoribonuclease L-PSP domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2709"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33284"
FT                   /db_xref="GOA:Q13RK5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK5"
FT                   /protein_id="ABE33284.1"
FT                   /translation="MNDATDIQEADVLVIGGGLHGTSSAFHMARRGANVIVLEADYVAR
FT                   HSSGVNAGGVRTLGRPLPEIPLALMSREIWHGMNDLLGEDGGFVPSGQLKIAETDDELE
FT                   ACRQRVALLESHGFTHEKVIDRQTVLDLEPALARHVTGGIWAERDGYALPYRTTTAFRL
FT                   AAQRLGARFLEGTPVRRIEQRGTRWFAVTPHGTFSAQKLLVTAGAWSGELAQQVGEPVP
FT                   VHPEGLMLMVTHRVAPFCSATLGATGRPLSFKQFDNGTVVIGGKLIGIADLAHRHGEVD
FT                   FVRLVRSARTVTDLFPHLRHLGVNRAWAGVEAFTEDELPVISASRKASDLYYSFGYCGS
FT                   GFQLGPGCGKLVSELMLDGAPSISLDAFAIDRFGRNAASSLTRAASLATH"
     MNDATDIQEA DVLVIGGGLH GTSSAFHMAR RGANVIVLEA DYVARHSSGV NAGGVRTLGR        60
     PLPEIPLALM SREIWHGMND LLGEDGGFVP SGQLKIAETD DELEACRQRV ALLESHGFTH       120
     EKVIDRQTVL DLEPALARHV TGGIWAERDG YALPYRTTTA FRLAAQRLGA RFLEGTPVRR       180
     IEQRGTRWFA VTPHGTFSAQ KLLVTAGAWS GELAQQVGEP VPVHPEGLML MVTHRVAPFC       240
     SATLGATGRP LSFKQFDNGT VVIGGKLIGI ADLAHRHGEV DFVRLVRSAR TVTDLFPHLR       300
     HLGVNRAWAG VEAFTEDELP VISASRKASD LYYSFGYCGS GFQLGPGCGK LVSELMLDGA       360
     PSISLDAFAI DRFGRNAASS LTRAASLATH                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page