(data stored in ACNUC7421 zone)

EMBL: CP000271.PE317

CP000271.PE317       Location/Qualifiers
FT   CDS             complement(370636..372054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2708"
FT                   /product="Putative opine oxidase subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2708"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33285"
FT                   /db_xref="GOA:Q13RK4"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK4"
FT                   /protein_id="ABE33285.1"
FT                   /translation="MAADFASEFASETVDVVVVGAGPAGMSAATRTARAGLRTVLIDEQ
FT                   DAVGGQIYRGIGRADARRKEILGPDYAAGAAIADAFAASGAHHVTNATVWQVTRERGVN
FT                   YLKDGKIGSFDAKCVILASGALERPFPIPGWTLPGVLTAGAAQILLKSAGEVPAAPPVL
FT                   AGCGPLLYLLGWQYVRAGVPIRALVDTTRHEDRWRAKRHVVSALRAWPFLSKGLQLIRT
FT                   LRQAGVPIFEAADDLRVEARIGTDHVERAAALHFTTQGTAHRIEADVILLHQGVVPNTQ
FT                   FTQALRAAHRWDNAQLCFTPKVDAWGELDVPGIFIAGDGAGIGGAQAAALQGTLAGLAA
FT                   AAQLGALTTAMRDAEAVAHRRALADVMRIRPFLDSLYRPRDINRIPRDETIVCRCEEVT
FT                   AGELRKFVELGCVGPNQAKSFGRCGMGPCQGRMCGLTVTEVIADARRVSPAEVGYYRIR
FT                   PPIKPLTLGELAGE"
     MAADFASEFA SETVDVVVVG AGPAGMSAAT RTARAGLRTV LIDEQDAVGG QIYRGIGRAD        60
     ARRKEILGPD YAAGAAIADA FAASGAHHVT NATVWQVTRE RGVNYLKDGK IGSFDAKCVI       120
     LASGALERPF PIPGWTLPGV LTAGAAQILL KSAGEVPAAP PVLAGCGPLL YLLGWQYVRA       180
     GVPIRALVDT TRHEDRWRAK RHVVSALRAW PFLSKGLQLI RTLRQAGVPI FEAADDLRVE       240
     ARIGTDHVER AAALHFTTQG TAHRIEADVI LLHQGVVPNT QFTQALRAAH RWDNAQLCFT       300
     PKVDAWGELD VPGIFIAGDG AGIGGAQAAA LQGTLAGLAA AAQLGALTTA MRDAEAVAHR       360
     RALADVMRIR PFLDSLYRPR DINRIPRDET IVCRCEEVTA GELRKFVELG CVGPNQAKSF       420
     GRCGMGPCQG RMCGLTVTEV IADARRVSPA EVGYYRIRPP IKPLTLGELA GE               472
//

If you have problems or comments...

PBIL Back to PBIL home page