(data stored in ACNUC7421 zone)

EMBL: CP000271.PE318

CP000271.PE318       Location/Qualifiers
FT   CDS             complement(372044..372415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2707"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2707"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33286"
FT                   /db_xref="GOA:Q13RK3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK3"
FT                   /protein_id="ABE33286.1"
FT                   /translation="MTTQPTHTLFKPLPGAQGAAAANVAIWFNDQPLSVPGGRSVAAAL
FT                   LAAGVSRFRATPVSGAPRGPFCMMGACFECLVEIDGVPSRQACMVEVKAGMRIHSQEGA
FT                   RDLPPASMTDAPLENAHGR"
     MTTQPTHTLF KPLPGAQGAA AANVAIWFND QPLSVPGGRS VAAALLAAGV SRFRATPVSG        60
     APRGPFCMMG ACFECLVEID GVPSRQACMV EVKAGMRIHS QEGARDLPPA SMTDAPLENA       120
     HGR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page