(data stored in ACNUC7421 zone)

EMBL: CP000271.PE320

CP000271.PE320       Location/Qualifiers
FT   CDS             complement(373556..374353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2705"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2705"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33288"
FT                   /db_xref="GOA:Q13RK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK1"
FT                   /protein_id="ABE33288.1"
FT                   /translation="MKQNGILGLVYNAFFLTFILAPLVVVMLVAFTDKGFISMPFDGAS
FT                   LRWFRAILENDDIVSAFWLSVRLAFVAATIGVLLAVPAALAIARYRFPGRAALTSFFLS
FT                   PMMIPAVVLGIAFLRFLSLLHLSGSFWSLVCAHVIIVLPYALRLALSSAVGLDRDAERA
FT                   ALSCGASRFTAFRRVVLPMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYN
FT                   QIAQTIDPLVASVSAVLIVGTVLLMILLDRMVGLDRILIGEAR"
     MKQNGILGLV YNAFFLTFIL APLVVVMLVA FTDKGFISMP FDGASLRWFR AILENDDIVS        60
     AFWLSVRLAF VAATIGVLLA VPAALAIARY RFPGRAALTS FFLSPMMIPA VVLGIAFLRF       120
     LSLLHLSGSF WSLVCAHVII VLPYALRLAL SSAVGLDRDA ERAALSCGAS RFTAFRRVVL       180
     PMIRTGVAGG WVLSFIQSFD ELTMTIFVAT PGTTTLPVAM YNQIAQTIDP LVASVSAVLI       240
     VGTVLLMILL DRMVGLDRIL IGEAR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page