(data stored in ACNUC7421 zone)

EMBL: CP000271.PE321

CP000271.PE321       Location/Qualifiers
FT   CDS             complement(374370..375242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2704"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2704"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33289"
FT                   /db_xref="GOA:Q13RK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK0"
FT                   /protein_id="ABE33289.1"
FT                   /translation="MATLDDARPGAAPWLLSGPALLLFVGLLLVPLLLTLMLSFRVFSD
FT                   TAGVTAAYTLANYWEVVSDPYYGTIFLRTAGLAFAVTLLSIVLGVPETIVLARMKRPWQ
FT                   SLCLLIVLGPLLISVVVRTLGWQILLGNNGVLNNILQTLHITDEPIRLVFTMTGMIIAL
FT                   THVLVPFMVMSVWATMQKLDPQVEWAGRSLGGSPFAVFRRVVLPQIMPGVLSGSIIVFA
FT                   LSASAFATPALIGGRRLKVVATAAYDEFLGTLNSPLGASIAVLLLIANVAIVMGCSRLA
FT                   ERRFQHIFD"
     MATLDDARPG AAPWLLSGPA LLLFVGLLLV PLLLTLMLSF RVFSDTAGVT AAYTLANYWE        60
     VVSDPYYGTI FLRTAGLAFA VTLLSIVLGV PETIVLARMK RPWQSLCLLI VLGPLLISVV       120
     VRTLGWQILL GNNGVLNNIL QTLHITDEPI RLVFTMTGMI IALTHVLVPF MVMSVWATMQ       180
     KLDPQVEWAG RSLGGSPFAV FRRVVLPQIM PGVLSGSIIV FALSASAFAT PALIGGRRLK       240
     VVATAAYDEF LGTLNSPLGA SIAVLLLIAN VAIVMGCSRL AERRFQHIFD                  290
//

If you have problems or comments...

PBIL Back to PBIL home page