(data stored in SCRATCH zone)

EMBL: CP000271.PE322

CP000271.PE322       Location/Qualifiers
FT   CDS             complement(375229..376308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2703"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33290"
FT                   /db_xref="GOA:Q13RJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ9"
FT                   /protein_id="ABE33290.1"
FT                   /translation="MAFLTLQNISKRYGDFTAIEHLDLSVERGELLSLLGPSGCGKTTT
FT                   LQMVAGFVTPTTGSILLDGRDITHERPEKRGIGVVFQSYALFPHMTVAGNVGFGLEMRK
FT                   VRRKEREERVAEALSLVRLKGLGHRYPKELSGGQRQRVAIARAIAMQPELLLLDEPMSN
FT                   LDAKLREEMHIELRTIQKRLGITTILVTHDQVEAMTMSDRIAVMHRGTIAQLSTPYDAY
FT                   ERPATPFASTFLGRTNAFSGEVLRRNPRCAEVDVAGTTLHVPHEGRHVVGAVNVYIRPE
FT                   KVYLANGDARVRGRISTRVFVGNQWLLEVDTELGKLRIAQPNHGAPPPEEGQEVGLAWT
FT                   DDDLRVLTQDNPERTHGHA"
     MAFLTLQNIS KRYGDFTAIE HLDLSVERGE LLSLLGPSGC GKTTTLQMVA GFVTPTTGSI        60
     LLDGRDITHE RPEKRGIGVV FQSYALFPHM TVAGNVGFGL EMRKVRRKER EERVAEALSL       120
     VRLKGLGHRY PKELSGGQRQ RVAIARAIAM QPELLLLDEP MSNLDAKLRE EMHIELRTIQ       180
     KRLGITTILV THDQVEAMTM SDRIAVMHRG TIAQLSTPYD AYERPATPFA STFLGRTNAF       240
     SGEVLRRNPR CAEVDVAGTT LHVPHEGRHV VGAVNVYIRP EKVYLANGDA RVRGRISTRV       300
     FVGNQWLLEV DTELGKLRIA QPNHGAPPPE EGQEVGLAWT DDDLRVLTQD NPERTHGHA        359
//

If you have problems or comments...

PBIL Back to PBIL home page