(data stored in ACNUC7421 zone)

EMBL: CP000271.PE323

CP000271.PE323       Location/Qualifiers
FT   CDS             complement(376367..377518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2702"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2702"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33291"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ8"
FT                   /protein_id="ABE33291.1"
FT                   /translation="MIGRRETAFYSTGSEARPPPTPELEIVVMRSALHRRLSAPSRTAI
FT                   AALSFVSALAAPLAAHAETTLYVANVGGSNEQVYRQKIIPPFEKAHNVRIVYVAGNSSD
FT                   TLAKLQAQKGHQQINVAVMDDGPMYQAMQLNLCAKLDDAPVMKDLYPLAKLGPTAIGVG
FT                   MVATGIGYNEEAFRKAGLPPPDSWKALTDPRIKGKLGVPPITNTYGLHTLVMLARLSGG
FT                   GEKNIDPGFTAMTKQVAPNVLSWAPTPGEMDGQMQSGDVILAPYGSGRAVALQNTGFPL
FT                   KFIYPKEGAVALQVAACVVAENAQPQLSQQFVQYLLSPEVQALQAQGIGLGPVNKTVKL
FT                   TPEVAARVPYGPEQISKLTAMDWTTINQHRTEWTERWNRSVER"
     MIGRRETAFY STGSEARPPP TPELEIVVMR SALHRRLSAP SRTAIAALSF VSALAAPLAA        60
     HAETTLYVAN VGGSNEQVYR QKIIPPFEKA HNVRIVYVAG NSSDTLAKLQ AQKGHQQINV       120
     AVMDDGPMYQ AMQLNLCAKL DDAPVMKDLY PLAKLGPTAI GVGMVATGIG YNEEAFRKAG       180
     LPPPDSWKAL TDPRIKGKLG VPPITNTYGL HTLVMLARLS GGGEKNIDPG FTAMTKQVAP       240
     NVLSWAPTPG EMDGQMQSGD VILAPYGSGR AVALQNTGFP LKFIYPKEGA VALQVAACVV       300
     AENAQPQLSQ QFVQYLLSPE VQALQAQGIG LGPVNKTVKL TPEVAARVPY GPEQISKLTA       360
     MDWTTINQHR TEWTERWNRS VER                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page