(data stored in ACNUC7421 zone)

EMBL: CP000271.PE326

CP000271.PE326       Location/Qualifiers
FT   CDS             379348..380214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2699"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2699"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33294"
FT                   /db_xref="GOA:Q13RJ5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ5"
FT                   /protein_id="ABE33294.1"
FT                   /translation="MVGMTADLGKYTDLHIFGKEFPERYYQMGMAEQLLMGAAAGMAHE
FT                   GAQPFVTTYAVFATRRAYDFMHQAIAEDNLDVKIICALPGLTTGYGPSHQAAEDLALMR
FT                   AMPNMTVIDPCDALDTEQMVPAIAAHNGPVYARLLRGNVPAVLDEYDYQFELGKAKLLR
FT                   DGAEVLIISSGIMTMRSLEVAKLLQADKVGVGVLHVPTIKPLDTETILREARRTGRMVV
FT                   VAENHSVIGGLGEAVATTLLTAGVTPTYRQIALPDQFLAAGALPTLHDRYGISTSVMAE
FT                   NIKGWLG"
     MVGMTADLGK YTDLHIFGKE FPERYYQMGM AEQLLMGAAA GMAHEGAQPF VTTYAVFATR        60
     RAYDFMHQAI AEDNLDVKII CALPGLTTGY GPSHQAAEDL ALMRAMPNMT VIDPCDALDT       120
     EQMVPAIAAH NGPVYARLLR GNVPAVLDEY DYQFELGKAK LLRDGAEVLI ISSGIMTMRS       180
     LEVAKLLQAD KVGVGVLHVP TIKPLDTETI LREARRTGRM VVVAENHSVI GGLGEAVATT       240
     LLTAGVTPTY RQIALPDQFL AAGALPTLHD RYGISTSVMA ENIKGWLG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page