(data stored in ACNUC7421 zone)

EMBL: CP000271.PE327

CP000271.PE327       Location/Qualifiers
FT   CDS             380545..380853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2698"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ4"
FT                   /protein_id="ABE33295.1"
FT                   /translation="MNKATSTLIAAVAALALSGGAYAQSNNTLATPSVVSPAAVSPANA
FT                   TSGYGTSGATNSDSGMSGGSANPGLQQTTNTSSTPNASAYGVNNTLATPGTASPAGK"
     MNKATSTLIA AVAALALSGG AYAQSNNTLA TPSVVSPAAV SPANATSGYG TSGATNSDSG        60
     MSGGSANPGL QQTTNTSSTP NASAYGVNNT LATPGTASPA GK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page