(data stored in SCRATCH zone)

EMBL: CP000271.PE33

CP000271.PE33        Location/Qualifiers
FT   CDS             35915..36631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2995"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33001"
FT                   /db_xref="GOA:Q13SD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD8"
FT                   /protein_id="ABE33001.1"
FT                   /translation="MIQRPARLIGSLVAIGVVVALLGRAIDFGALHQYTPDLVYYTKRH
FT                   LLLVGYSMALALLVGIPAGVLLSRPSFARHAERFMQIFNIGNTIPSLAVLAIALGIFGI
FT                   GDIPALIALFLASLLPITRNAYEGMKNVSPALREAARGLGMTGWQSLLRVELPNAMPII
FT                   IGGVRTALAINVGSAPLAYLIGADSLGTLIFPGIYLNNQQQLLLGAAATAILALVLDGI
FT                   VSAGSRYLLARRGVTA"
     MIQRPARLIG SLVAIGVVVA LLGRAIDFGA LHQYTPDLVY YTKRHLLLVG YSMALALLVG        60
     IPAGVLLSRP SFARHAERFM QIFNIGNTIP SLAVLAIALG IFGIGDIPAL IALFLASLLP       120
     ITRNAYEGMK NVSPALREAA RGLGMTGWQS LLRVELPNAM PIIIGGVRTA LAINVGSAPL       180
     AYLIGADSLG TLIFPGIYLN NQQQLLLGAA ATAILALVLD GIVSAGSRYL LARRGVTA         238
//

If you have problems or comments...

PBIL Back to PBIL home page