(data stored in ACNUC7421 zone)

EMBL: CP000271.PE331

CP000271.PE331       Location/Qualifiers
FT   CDS             complement(384709..385455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2694"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2694"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33299"
FT                   /db_xref="GOA:Q13RJ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ0"
FT                   /protein_id="ABE33299.1"
FT                   /translation="MPAHLPNLNDRVALVTGGSRGIGRAISIALAAAGASVAVNYRQRG
FT                   NEAAGVVAEIERAGGRAIAVRADVSVADDVKAMFREVENHLGLIDVLVNNAGTGTIVDI
FT                   DDLTEAEFDRTLAVNLKSAFLCTQAALPGMRARHWGRIVNLSSAAARGAGLLGVHYNAS
FT                   KAGVEGLTRGYAAKLAREGITVNAVAPGPIDTEMAGPLKAANVADKLPVGRLGEASEVA
FT                   QAVLMVVGNAFITGQTIPVNGGVSFI"
     MPAHLPNLND RVALVTGGSR GIGRAISIAL AAAGASVAVN YRQRGNEAAG VVAEIERAGG        60
     RAIAVRADVS VADDVKAMFR EVENHLGLID VLVNNAGTGT IVDIDDLTEA EFDRTLAVNL       120
     KSAFLCTQAA LPGMRARHWG RIVNLSSAAA RGAGLLGVHY NASKAGVEGL TRGYAAKLAR       180
     EGITVNAVAP GPIDTEMAGP LKAANVADKL PVGRLGEASE VAQAVLMVVG NAFITGQTIP       240
     VNGGVSFI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page