(data stored in ACNUC7421 zone)

EMBL: CP000271.PE332

CP000271.PE332       Location/Qualifiers
FT   CDS             385681..387087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2693"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33300"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI9"
FT                   /protein_id="ABE33300.1"
FT                   /translation="MYSKTQIDPVVSFRNSQGEQVRGTIINLQRKSLVMEVYNPYSIVQ
FT                   VSEVLSDLSVKMGTEHAYSGKAVVISMVNTGLTAIVSVTLIAEWLELSGGALEAPAVGE
FT                   EARRFVQDWSERFKIRRDYQIAVNQIRAFLSDMSRWVEQADLVDTMPKEGKTLRQDFFL
FT                   ELASPLMERTKVYFDEFEGEARLVDEELAPAHRAFAQAALHPLLLRSPFVFRTFTKPLG
FT                   YAGDYQMVNQMLDDPRQGPSTYFQIVNAAFLQTAVARAHRNRVELLVDYLTRLANEARA
FT                   AQRPFRVLNVGCGPAQEIQRFMHEYDEPEWLTFELLDFSQETLDWTRDRLGSIAQKTGR
FT                   RMTISYTHDSVHHLLKRRMDADAADVREFDAVYCAGLFDYLSDKVCARLNQHFASRTRR
FT                   GGRLLVTNVHADNPERFSMEHVLEWYLIYRNEAQMAEIMPDSCGEPRLYTDSTGVNVFA
FT                   EATIGPQQVA"
     MYSKTQIDPV VSFRNSQGEQ VRGTIINLQR KSLVMEVYNP YSIVQVSEVL SDLSVKMGTE        60
     HAYSGKAVVI SMVNTGLTAI VSVTLIAEWL ELSGGALEAP AVGEEARRFV QDWSERFKIR       120
     RDYQIAVNQI RAFLSDMSRW VEQADLVDTM PKEGKTLRQD FFLELASPLM ERTKVYFDEF       180
     EGEARLVDEE LAPAHRAFAQ AALHPLLLRS PFVFRTFTKP LGYAGDYQMV NQMLDDPRQG       240
     PSTYFQIVNA AFLQTAVARA HRNRVELLVD YLTRLANEAR AAQRPFRVLN VGCGPAQEIQ       300
     RFMHEYDEPE WLTFELLDFS QETLDWTRDR LGSIAQKTGR RMTISYTHDS VHHLLKRRMD       360
     ADAADVREFD AVYCAGLFDY LSDKVCARLN QHFASRTRRG GRLLVTNVHA DNPERFSMEH       420
     VLEWYLIYRN EAQMAEIMPD SCGEPRLYTD STGVNVFAEA TIGPQQVA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page