(data stored in ACNUC7421 zone)

EMBL: CP000271.PE333

CP000271.PE333       Location/Qualifiers
FT   CDS             387089..388426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2692"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2692"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33301"
FT                   /db_xref="GOA:Q13RI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI8"
FT                   /protein_id="ABE33301.1"
FT                   /translation="MTTSLAGLHSNYREELRDYRLLCSKAGGLTVIVLVLMGVALDYVV
FT                   YPAEQKRFAIVRVLTSAAIGLALLSLCTEAGKRHVQIITFFWLLLPQAMISWMIYVTQG
FT                   GESLFYAGLMLTIFAVGILFPSGYWQTLAFGLVTVLLYYVACAAHPGGIQNPSKFQFQL
FT                   ILIFFCALASSIYTYFNEKGRFQLFRLKDEVAHKNDQLARTNDNLAQIKGQLLQQEKMA
FT                   AIGTLSAGLLHEVNNPVNFCLMAIEVAMEEPQAKDSPSLQECLTDVKQGMLRIQHIVSD
FT                   LKTFAYRKPGATADDVPFLFEKALDASIRLSAHELRGVNVTRELPGDTLVLGDEAAIIG
FT                   VLINLFSNAALAMHKAGTVSPQVRITAQWRDDRLHVNVRDNGPGIAAENLARVFEPFFT
FT                   TRDVGQGLGLGLSISYAVVERHGGTLFAESQLGEWTAFNFDLPRVE"
     MTTSLAGLHS NYREELRDYR LLCSKAGGLT VIVLVLMGVA LDYVVYPAEQ KRFAIVRVLT        60
     SAAIGLALLS LCTEAGKRHV QIITFFWLLL PQAMISWMIY VTQGGESLFY AGLMLTIFAV       120
     GILFPSGYWQ TLAFGLVTVL LYYVACAAHP GGIQNPSKFQ FQLILIFFCA LASSIYTYFN       180
     EKGRFQLFRL KDEVAHKNDQ LARTNDNLAQ IKGQLLQQEK MAAIGTLSAG LLHEVNNPVN       240
     FCLMAIEVAM EEPQAKDSPS LQECLTDVKQ GMLRIQHIVS DLKTFAYRKP GATADDVPFL       300
     FEKALDASIR LSAHELRGVN VTRELPGDTL VLGDEAAIIG VLINLFSNAA LAMHKAGTVS       360
     PQVRITAQWR DDRLHVNVRD NGPGIAAENL ARVFEPFFTT RDVGQGLGLG LSISYAVVER       420
     HGGTLFAESQ LGEWTAFNFD LPRVE                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page