(data stored in ACNUC7421 zone)

EMBL: CP000271.PE334

CP000271.PE334       Location/Qualifiers
FT   CDS             388434..388838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2691"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2691"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33302"
FT                   /db_xref="GOA:Q13RI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI7"
FT                   /protein_id="ABE33302.1"
FT                   /translation="MRETQQARHTVVYVDDEELARKYFARAAGSDFEVLLADGADEAMT
FT                   ILRREGPRVAILVTDFRMPGRHGGDLLRQVSQEYPHIVRILVTAYADKNALLEAVNSGE
FT                   VFQILEKPLGVGRVREVLASAATAPVLRPK"
     MRETQQARHT VVYVDDEELA RKYFARAAGS DFEVLLADGA DEAMTILRRE GPRVAILVTD        60
     FRMPGRHGGD LLRQVSQEYP HIVRILVTAY ADKNALLEAV NSGEVFQILE KPLGVGRVRE       120
     VLASAATAPV LRPK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page