(data stored in ACNUC7421 zone)

EMBL: CP000271.PE339

CP000271.PE339       Location/Qualifiers
FT   CDS             complement(392261..395146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2686"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2686"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33307"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI2"
FT                   /protein_id="ABE33307.1"
FT                   /translation="MRVRQKSRNGTRREAGTLLLAALAGLPFMAMASPASPHADTAAVL
FT                   SGASSHAADPRLALANRTTPCALMLDNRGWSVTPFEKPKDERARCMNEAAQGNLTARAL
FT                   YGQMLTYGYGGERDTATGVAILKSSALDGSLLARRMLGNLYRNGSVVPQDYLAARQWFE
FT                   SAAADGDATSATVLGAMSANGEGQPVDNAAAYRYFVQAAEGGSANGAANAAQFAALGRG
FT                   VPKDPAVAASWMIRGASGGDAGAQFLLGLALLRGEGVPRDAGNGAGWLREAVRQGNTGA
FT                   EAALGDVYLSGVGVQRDTRRGFDLMSHAARQGWVYAQRRMGDLYATGTGVARNDVLARS
FT                   WYRKAAVEGDAAARFALADLYRTGRGGPVDLEAAIGWMRGAADAGLATAQNDLGVMFRE
FT                   GWGTHKDSAEARTWFEKARAQGLGVASFNLAIYALRGEGEPVDFGKAFKLASEGADRGS
FT                   EEAAVTAAAMAWKGQGTPVDKAQALRWYRFAADHGNVEAARWIGNQYLAGTEVPRDEAL
FT                   GLHYLTLATNAGDPASSVSLGAYLTEHGQSLSGKTGVEWLEAAAKRRVPAAYAALGYTY
FT                   ARGIAGKQDSGVALGWFSQGAQLGDPASQAWLCSAYAYGSPGVQRRPDYAARWCQAASR
FT                   SGNVLAMSILADARNGIANDTSRVYWQWKVADRGDPKYQSMLGDSYDLGDGVAPDLSAA
FT                   TYWFRRAADQGNASAQSSLAWHLLTGLGGRVDEYEAFAWASKAAPADPEAKRMVGVAYA
FT                   YGRGVGRDPAAGRVWLEKALAAGDDWAASDLATLYEIGPLAQREPARAMQLHRQGARGG
FT                   AEQSQIALALHALAAGTETDLGNNERRWLVPADAASNLWHDDSLAPAGELRQRWDGLSC
FT                   LNEALLGNPLMQYDVGMRFLTGNGVPRDRALGAAWIARARAGFEARGGVPAYTAAIRIV
FT                   EARLSERMGDDEKQRAREIAANLDATVREWQ"
     MRVRQKSRNG TRREAGTLLL AALAGLPFMA MASPASPHAD TAAVLSGASS HAADPRLALA        60
     NRTTPCALML DNRGWSVTPF EKPKDERARC MNEAAQGNLT ARALYGQMLT YGYGGERDTA       120
     TGVAILKSSA LDGSLLARRM LGNLYRNGSV VPQDYLAARQ WFESAAADGD ATSATVLGAM       180
     SANGEGQPVD NAAAYRYFVQ AAEGGSANGA ANAAQFAALG RGVPKDPAVA ASWMIRGASG       240
     GDAGAQFLLG LALLRGEGVP RDAGNGAGWL REAVRQGNTG AEAALGDVYL SGVGVQRDTR       300
     RGFDLMSHAA RQGWVYAQRR MGDLYATGTG VARNDVLARS WYRKAAVEGD AAARFALADL       360
     YRTGRGGPVD LEAAIGWMRG AADAGLATAQ NDLGVMFREG WGTHKDSAEA RTWFEKARAQ       420
     GLGVASFNLA IYALRGEGEP VDFGKAFKLA SEGADRGSEE AAVTAAAMAW KGQGTPVDKA       480
     QALRWYRFAA DHGNVEAARW IGNQYLAGTE VPRDEALGLH YLTLATNAGD PASSVSLGAY       540
     LTEHGQSLSG KTGVEWLEAA AKRRVPAAYA ALGYTYARGI AGKQDSGVAL GWFSQGAQLG       600
     DPASQAWLCS AYAYGSPGVQ RRPDYAARWC QAASRSGNVL AMSILADARN GIANDTSRVY       660
     WQWKVADRGD PKYQSMLGDS YDLGDGVAPD LSAATYWFRR AADQGNASAQ SSLAWHLLTG       720
     LGGRVDEYEA FAWASKAAPA DPEAKRMVGV AYAYGRGVGR DPAAGRVWLE KALAAGDDWA       780
     ASDLATLYEI GPLAQREPAR AMQLHRQGAR GGAEQSQIAL ALHALAAGTE TDLGNNERRW       840
     LVPADAASNL WHDDSLAPAG ELRQRWDGLS CLNEALLGNP LMQYDVGMRF LTGNGVPRDR       900
     ALGAAWIARA RAGFEARGGV PAYTAAIRIV EARLSERMGD DEKQRAREIA ANLDATVREW       960
     Q                                                                       961
//

If you have problems or comments...

PBIL Back to PBIL home page