(data stored in SCRATCH zone)

EMBL: CP000271.PE34

CP000271.PE34        Location/Qualifiers
FT   CDS             36628..37524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2994"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33002"
FT                   /db_xref="GOA:Q13SD7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD7"
FT                   /protein_id="ABE33002.1"
FT                   /translation="MIDLFKRIRWIAAGALFCASLQAGAATLVLGGKNFTEQYVLTEIT
FT                   SQYLRAKGYTIDARTGLGSTLLRSAQENGQVDITWEYTGTAAIVYNKITEKLDPKTMYE
FT                   RVKALDAKRGLVWLDCSPLNNTYALGLPQQVAQQTGIRTISQLAAKMAAEPKKKHVFAM
FT                   DAEFANRPDGLKPLEAAYGMQFSREETRQMDPGLVYTALHNNQVPIGLIYTTDGRVKGF
FT                   NIVPLEDDRHYFPAYNATPVVRKATLDQNPQLAPQLNALSDALNNDTMLEMNKQVDVDG
FT                   RPVREVAAEFLRTHKLP"
     MIDLFKRIRW IAAGALFCAS LQAGAATLVL GGKNFTEQYV LTEITSQYLR AKGYTIDART        60
     GLGSTLLRSA QENGQVDITW EYTGTAAIVY NKITEKLDPK TMYERVKALD AKRGLVWLDC       120
     SPLNNTYALG LPQQVAQQTG IRTISQLAAK MAAEPKKKHV FAMDAEFANR PDGLKPLEAA       180
     YGMQFSREET RQMDPGLVYT ALHNNQVPIG LIYTTDGRVK GFNIVPLEDD RHYFPAYNAT       240
     PVVRKATLDQ NPQLAPQLNA LSDALNNDTM LEMNKQVDVD GRPVREVAAE FLRTHKLP         298
//

If you have problems or comments...

PBIL Back to PBIL home page