(data stored in ACNUC7421 zone)

EMBL: CP000271.PE340

CP000271.PE340       Location/Qualifiers
FT   CDS             complement(395143..396516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33308"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI1"
FT                   /protein_id="ABE33308.1"
FT                   /translation="MKLKTSFYGVMLFFTAVSANALDMRSAQPVAPAAQAQTAAPVDPA
FT                   ALTNERIRQIVGQAGLDPDSDKGRLLVKLVTRVAADAEFRNRLSTWSQTRGMFGGQLSP
FT                   DDRMRVLHLLKGLAQGPKSDCDALATNGRDFFLMAKTLSTQSFQNLLEIMEISVDHSTP
FT                   DSNDERYTTAELLDADAELESKVPSQFIAKGPSNACELIRVAVDAVDGLPPASRQAATY
FT                   ELFQIMDHKPSARAKVLTDPYAYLDDMFDERRMPDSIRRKLPENGSRPLPFSRLVVDAE
FT                   WKNPSTPNQPTPFKDTFVNRRNNGVVAELVTPAADSARLDWSDFYLSYGVASLLTQTVG
FT                   THELTPLGTLKDDVAVDTASRPLVEGHSIELALPLPSEKGETSRTCEIGKTVPASTLFR
FT                   SLDGDAVGLHCQSVTKRGETVRFDASLLVNYGIAWTTSIDDKDGRTDAIIRNVTVQQP"
     MKLKTSFYGV MLFFTAVSAN ALDMRSAQPV APAAQAQTAA PVDPAALTNE RIRQIVGQAG        60
     LDPDSDKGRL LVKLVTRVAA DAEFRNRLST WSQTRGMFGG QLSPDDRMRV LHLLKGLAQG       120
     PKSDCDALAT NGRDFFLMAK TLSTQSFQNL LEIMEISVDH STPDSNDERY TTAELLDADA       180
     ELESKVPSQF IAKGPSNACE LIRVAVDAVD GLPPASRQAA TYELFQIMDH KPSARAKVLT       240
     DPYAYLDDMF DERRMPDSIR RKLPENGSRP LPFSRLVVDA EWKNPSTPNQ PTPFKDTFVN       300
     RRNNGVVAEL VTPAADSARL DWSDFYLSYG VASLLTQTVG THELTPLGTL KDDVAVDTAS       360
     RPLVEGHSIE LALPLPSEKG ETSRTCEIGK TVPASTLFRS LDGDAVGLHC QSVTKRGETV       420
     RFDASLLVNY GIAWTTSIDD KDGRTDAIIR NVTVQQP                                457
//

If you have problems or comments...

PBIL Back to PBIL home page