(data stored in ACNUC7421 zone)

EMBL: CP000271.PE344

CP000271.PE344       Location/Qualifiers
FT   CDS             399817..400260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2681"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH7"
FT                   /protein_id="ABE33312.1"
FT                   /translation="MNRLIIYIVVVASFLVFPGTTAAWLPFGNEVTVYMLSCDGEQKSG
FT                   LCHGREKTDIPFTYKVLADQLSVWYWRADDPDEPRRLSFCAIHDMKNWLCQWGSEEIPK
FT                   SRFGMVSGRYAEIATCVTVTSTPLFYQVSRLRWWFVWLREQLS"
     MNRLIIYIVV VASFLVFPGT TAAWLPFGNE VTVYMLSCDG EQKSGLCHGR EKTDIPFTYK        60
     VLADQLSVWY WRADDPDEPR RLSFCAIHDM KNWLCQWGSE EIPKSRFGMV SGRYAEIATC       120
     VTVTSTPLFY QVSRLRWWFV WLREQLS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page