(data stored in ACNUC7421 zone)

EMBL: CP000271.PE347

CP000271.PE347       Location/Qualifiers
FT   CDS             403883..404167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2678"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33315"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH4"
FT                   /protein_id="ABE33315.1"
FT                   /translation="MRADQLLPDHADHIDVHGATIRKGTIAAFLANALVWSDAHASEPA
FT                   RAQAAADIVDALPALRASGLFGVLEIRDPELRAWIDAQLAGLPSDEVRS"
     MRADQLLPDH ADHIDVHGAT IRKGTIAAFL ANALVWSDAH ASEPARAQAA ADIVDALPAL        60
     RASGLFGVLE IRDPELRAWI DAQLAGLPSD EVRS                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page