(data stored in ACNUC7421 zone)

EMBL: CP000271.PE349

CP000271.PE349       Location/Qualifiers
FT   CDS             405256..406461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2676"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2676"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33317"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH2"
FT                   /protein_id="ABE33317.1"
FT                   /translation="MTQIFSDALHEQLGMWPIAYIPYGGADFGEVRSVAQTIGDGDDNA
FT                   FYDAWTEAADRMMDEGRVAEAHGHRVSAREYYLRAACFYAKAFHPHFGYPVDPRIFESS
FT                   RWQIDAFNRALALGDDPVEPVRIPFETSSMLAYVIPAQGRPNERRPLLILTNGYDGTIT
FT                   DPFFASAVAASRRGYHCLIFDGPGQGTTLIDQGIHMRPDWEIVIRAVVDFALTLPNVDA
FT                   SRIVSSGWSLGGYLSPRAASGEPRLAACVADPAQSCIADGFRAYAIKLGATPKQAAQLS
FT                   LLPDALIERMEEIIAHDRKLTWSFLKRGYWVNGASNLREYLASVEQFTMSGRIGNIQCP
FT                   TLFTLAEDDPLASGTQAFFDALQCPKKLLRFNKTQGAGEHCEMTNRSLLNRKVLDWLDE
FT                   VL"
     MTQIFSDALH EQLGMWPIAY IPYGGADFGE VRSVAQTIGD GDDNAFYDAW TEAADRMMDE        60
     GRVAEAHGHR VSAREYYLRA ACFYAKAFHP HFGYPVDPRI FESSRWQIDA FNRALALGDD       120
     PVEPVRIPFE TSSMLAYVIP AQGRPNERRP LLILTNGYDG TITDPFFASA VAASRRGYHC       180
     LIFDGPGQGT TLIDQGIHMR PDWEIVIRAV VDFALTLPNV DASRIVSSGW SLGGYLSPRA       240
     ASGEPRLAAC VADPAQSCIA DGFRAYAIKL GATPKQAAQL SLLPDALIER MEEIIAHDRK       300
     LTWSFLKRGY WVNGASNLRE YLASVEQFTM SGRIGNIQCP TLFTLAEDDP LASGTQAFFD       360
     ALQCPKKLLR FNKTQGAGEH CEMTNRSLLN RKVLDWLDEV L                           401
//

If you have problems or comments...

PBIL Back to PBIL home page