(data stored in ACNUC7421 zone)

EMBL: CP000271.PE35

CP000271.PE35        Location/Qualifiers
FT   CDS             37540..38193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2993"
FT                   /product="ABC glycine betaine/L-proline transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33003"
FT                   /db_xref="GOA:Q13SD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD6"
FT                   /protein_id="ABE33003.1"
FT                   /translation="MTVFDYLSANWPELLQLTAQHVWLVGIAVGCAIFVGVPLGILINW
FT                   HEWLAAPLLSIATVVLTLPSIALFGLMIPVFSRFGQGIGAVPAITAVFLYSLLPIMRNT
FT                   YLALRNVDAGIKEAGIGIGMTVWQRLRLVDLPLAVPVILGGVRTAVVMNIGVMTIAAVI
FT                   GAGGLGTLIIRAIGQSSMMKLLVGAVLVSVLAIVADLLLQALQRLLTPKGVQKT"
     MTVFDYLSAN WPELLQLTAQ HVWLVGIAVG CAIFVGVPLG ILINWHEWLA APLLSIATVV        60
     LTLPSIALFG LMIPVFSRFG QGIGAVPAIT AVFLYSLLPI MRNTYLALRN VDAGIKEAGI       120
     GIGMTVWQRL RLVDLPLAVP VILGGVRTAV VMNIGVMTIA AVIGAGGLGT LIIRAIGQSS       180
     MMKLLVGAVL VSVLAIVADL LLQALQRLLT PKGVQKT                                217
//

If you have problems or comments...

PBIL Back to PBIL home page