(data stored in ACNUC7421 zone)

EMBL: CP000271.PE355

CP000271.PE355       Location/Qualifiers
FT   CDS             411110..411769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2670"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2670"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33323"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG6"
FT                   /protein_id="ABE33323.1"
FT                   /translation="MKMGILGAGFIGRAMATLAKQSGYDVMISNSRGPQTLMSTAAAIG
FT                   CHVGTAREAAVFGDVVVVAVPFHSYPALPVAELEGKIVIDTCNYYPERDGHIDALDQYA
FT                   TTTSELIARHLHGARLVKAFNAILAKDLETDGTPPGTPHRRALPMAGDDLAAKQAVAGV
FT                   LDQFGFDAVDAGPLSASWRFERAKPVYCVRLDREGLLEKLAEAKRDVEVPHGSWRR"
     MKMGILGAGF IGRAMATLAK QSGYDVMISN SRGPQTLMST AAAIGCHVGT AREAAVFGDV        60
     VVVAVPFHSY PALPVAELEG KIVIDTCNYY PERDGHIDAL DQYATTTSEL IARHLHGARL       120
     VKAFNAILAK DLETDGTPPG TPHRRALPMA GDDLAAKQAV AGVLDQFGFD AVDAGPLSAS       180
     WRFERAKPVY CVRLDREGLL EKLAEAKRDV EVPHGSWRR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page