(data stored in ACNUC7421 zone)

EMBL: CP000271.PE356

CP000271.PE356       Location/Qualifiers
FT   CDS             411966..412367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33324"
FT                   /db_xref="GOA:Q13RG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG5"
FT                   /protein_id="ABE33324.1"
FT                   /translation="MSGEWKRRMKLFIQRFWQPTSACMTCMPGSWANVMSLAHWTIALQ
FT                   TGLLTGLLAVLLTFTPAARFYRHRYGSALIVGVLTTIGDFYSHESHYRIPYVEHFVTGA
FT                   ISGLLTLAASYLFEDRARRLRAAWARIFR"
     MSGEWKRRMK LFIQRFWQPT SACMTCMPGS WANVMSLAHW TIALQTGLLT GLLAVLLTFT        60
     PAARFYRHRY GSALIVGVLT TIGDFYSHES HYRIPYVEHF VTGAISGLLT LAASYLFEDR       120
     ARRLRAAWAR IFR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page