(data stored in ACNUC7421 zone)

EMBL: CP000271.PE358

CP000271.PE358       Location/Qualifiers
FT   CDS             412871..414214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2667"
FT                   /product="Putative chloride-channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33326"
FT                   /db_xref="GOA:Q13RG3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG3"
FT                   /protein_id="ABE33326.1"
FT                   /translation="MCFISLPRGYIPMRIHALADRRTILRIRRLWLHYGIFWLGAVATG
FT                   LVAVMYAKLIDFGYDTFLRYTTSHRWLPLLLTPAVAALGVWITRRWFVGAEGSGIPQVI
FT                   ATLHEGRELGPRLLSMRILIGKIGVSFLSILGGLTIGREGPTIHVGAALMFSLRRFYPA
FT                   RFRSIRGAALERNLALAGAAAGLSAAFNAPLAGVVFAIEELTRSFEQRTSGVLITAIIF
FT                   AGVVSLGLQGNYTYFGTIDIDGHFPDMLAIAAVMLGVVTGVAGGAFCWLLLNTNRWMPA
FT                   RLVVWRKDHPVAFGAACGLVIALIGVAAGGHTFGSGYAEARGMLEGNSQLGASYPILKM
FT                   ASMVGSYLPGAPGGLFAPSLAIGAGIGNALHLVFGQMQLPMLIALGMVGYLAAVTQSPI
FT                   TAFVIVIEMINGHALVLSLMTTALIASQVSRLFAPPLYEALSKRYVAG"
     MCFISLPRGY IPMRIHALAD RRTILRIRRL WLHYGIFWLG AVATGLVAVM YAKLIDFGYD        60
     TFLRYTTSHR WLPLLLTPAV AALGVWITRR WFVGAEGSGI PQVIATLHEG RELGPRLLSM       120
     RILIGKIGVS FLSILGGLTI GREGPTIHVG AALMFSLRRF YPARFRSIRG AALERNLALA       180
     GAAAGLSAAF NAPLAGVVFA IEELTRSFEQ RTSGVLITAI IFAGVVSLGL QGNYTYFGTI       240
     DIDGHFPDML AIAAVMLGVV TGVAGGAFCW LLLNTNRWMP ARLVVWRKDH PVAFGAACGL       300
     VIALIGVAAG GHTFGSGYAE ARGMLEGNSQ LGASYPILKM ASMVGSYLPG APGGLFAPSL       360
     AIGAGIGNAL HLVFGQMQLP MLIALGMVGY LAAVTQSPIT AFVIVIEMIN GHALVLSLMT       420
     TALIASQVSR LFAPPLYEAL SKRYVAG                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page