(data stored in SCRATCH zone)

EMBL: CP000271.PE36

CP000271.PE36        Location/Qualifiers
FT   CDS             38190..39392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2992"
FT                   /product="ABC glycine betaine/L-proline transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33004"
FT                   /db_xref="GOA:Q13SD5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD5"
FT                   /protein_id="ABE33004.1"
FT                   /translation="MIELDKLTKTFTQKDGQQVKAVDSVSLTVGEGEICVFLGPSGCGK
FT                   TTTLKMINRLIAPTSGRVLINGEDTSGLNEVELRRHIGYVIQQIGLFPNMTIEENITVV
FT                   PRLLGWDRKRCRERATELMSMVALEPKQYLKRYPRELSGGQQQRIGVIRALAADPPVLL
FT                   MDEPFGAVDPINRESIQNEFFQMQRQLNKTVIMVSHDIDEAIKLGDRVAVFRRGRLVQY
FT                   DHPDTLLAHPRDEFVGAFVGQDSTLKRLLLVKAGDAATQPGTARAAMPVARAFQMMDDS
FT                   DSRYLTIVDENQQALGYVTRRAARTGEGLCGDHLSTFKATVSADENLRIVLSKMYQFNS
FT                   SWMPVLDGDGRYVGEVTQDSIADYLSSGRSRRQTGQPAIVSPAVAAAEAAAAQVATADH
FT                   A"
     MIELDKLTKT FTQKDGQQVK AVDSVSLTVG EGEICVFLGP SGCGKTTTLK MINRLIAPTS        60
     GRVLINGEDT SGLNEVELRR HIGYVIQQIG LFPNMTIEEN ITVVPRLLGW DRKRCRERAT       120
     ELMSMVALEP KQYLKRYPRE LSGGQQQRIG VIRALAADPP VLLMDEPFGA VDPINRESIQ       180
     NEFFQMQRQL NKTVIMVSHD IDEAIKLGDR VAVFRRGRLV QYDHPDTLLA HPRDEFVGAF       240
     VGQDSTLKRL LLVKAGDAAT QPGTARAAMP VARAFQMMDD SDSRYLTIVD ENQQALGYVT       300
     RRAARTGEGL CGDHLSTFKA TVSADENLRI VLSKMYQFNS SWMPVLDGDG RYVGEVTQDS       360
     IADYLSSGRS RRQTGQPAIV SPAVAAAEAA AAQVATADHA                             400
//

If you have problems or comments...

PBIL Back to PBIL home page