(data stored in ACNUC7421 zone)

EMBL: CP000271.PE360

CP000271.PE360       Location/Qualifiers
FT   CDS             complement(415275..415946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2665"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2665"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33328"
FT                   /db_xref="GOA:Q13RG1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG1"
FT                   /protein_id="ABE33328.1"
FT                   /translation="MTLQDRLDAFKADFKAGKPPYHAPPEIHPIMERATAELVASGQAS
FT                   RAIKAGDRAPLFTLKDQNGNDVSSAELLAQGPLVVTFYRGVWCPYCNIELHAINEALPQ
FT                   IRARGANVVAISPQTAVNSRKSVRDNSLNFPVLSDAKGETAAAFGLRFSLPDYLVDLYK
FT                   NLRNDLPAFNDDPNWTLPMPARYIIGHDGIVLYSEVNPDYTHRPDPAEMFAVLDKANAK
FT                   D"
     MTLQDRLDAF KADFKAGKPP YHAPPEIHPI MERATAELVA SGQASRAIKA GDRAPLFTLK        60
     DQNGNDVSSA ELLAQGPLVV TFYRGVWCPY CNIELHAINE ALPQIRARGA NVVAISPQTA       120
     VNSRKSVRDN SLNFPVLSDA KGETAAAFGL RFSLPDYLVD LYKNLRNDLP AFNDDPNWTL       180
     PMPARYIIGH DGIVLYSEVN PDYTHRPDPA EMFAVLDKAN AKD                         223
//

If you have problems or comments...

PBIL Back to PBIL home page