(data stored in ACNUC7421 zone)

EMBL: CP000271.PE363

CP000271.PE363       Location/Qualifiers
FT   CDS             complement(417637..418296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33331"
FT                   /db_xref="GOA:Q13RF8"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF8"
FT                   /protein_id="ABE33331.1"
FT                   /translation="MPMSQEIDYLNPALPAGLRRVSMSVVDATPATLDGFGCLVTDPSK
FT                   CSIEIVQWPAAGTRPIDPGTGDEAGTTEGTFVSEWRGDILYGRNEAVGGNYILAYAREP
FT                   EAARDDHANAPERMLLWHANYHPDGGQLFFPLDHRPFYVPLALPGDDITPEKFVCFRFD
FT                   GQQGLYIHPNIWHEGVFTLEGTQRFFDKQGAVHARVSVDFAREFGCLLEAPIAGDA"
     MPMSQEIDYL NPALPAGLRR VSMSVVDATP ATLDGFGCLV TDPSKCSIEI VQWPAAGTRP        60
     IDPGTGDEAG TTEGTFVSEW RGDILYGRNE AVGGNYILAY AREPEAARDD HANAPERMLL       120
     WHANYHPDGG QLFFPLDHRP FYVPLALPGD DITPEKFVCF RFDGQQGLYI HPNIWHEGVF       180
     TLEGTQRFFD KQGAVHARVS VDFAREFGCL LEAPIAGDA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page