(data stored in ACNUC7421 zone)

EMBL: CP000271.PE365

CP000271.PE365       Location/Qualifiers
FT   CDS             complement(420542..420985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2660"
FT                   /product="Conserved hypothetical protein"
FT                   /note="DNA-binding domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33333"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF6"
FT                   /protein_id="ABE33333.1"
FT                   /translation="MQAHPLRLFPGDDLRVALENVLHQSGLQAAFVIQGIGSLSVAQLR
FT                   FAGKEDPTELRDDLEILTLAGSISPDGAHLHMSVADPRGQVSGGHVARGCVIRTTAEIL
FT                   LVLLPDYRFSRERDPGSGFMELVIRNEPATDHARQLRADNLDE"
     MQAHPLRLFP GDDLRVALEN VLHQSGLQAA FVIQGIGSLS VAQLRFAGKE DPTELRDDLE        60
     ILTLAGSISP DGAHLHMSVA DPRGQVSGGH VARGCVIRTT AEILLVLLPD YRFSRERDPG       120
     SGFMELVIRN EPATDHARQL RADNLDE                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page