(data stored in ACNUC7421 zone)

EMBL: CP000271.PE369

CP000271.PE369       Location/Qualifiers
FT   CDS             423653..424288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2656"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33337"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF2"
FT                   /protein_id="ABE33337.1"
FT                   /translation="MLLLKEPPSRAPLCPQTVAVPAGESRAIDVKAGQILRIEAKEPGA
FT                   VASMFGFSRINDDVYMSVHHTRVFSNSYVLQAGMRIVSNRRRALMVLGKDSSGKHDLLL
FT                   PASTTAYLAEQGYAGLTGCIESVGAVIQSLGLKPPKMPDPINLFMHVTLHQDGRIEPLP
FT                   NTTRAGDFVACRVVTDMVFIVSACCTGIPGNDVPGALELSAAEELDQL"
     MLLLKEPPSR APLCPQTVAV PAGESRAIDV KAGQILRIEA KEPGAVASMF GFSRINDDVY        60
     MSVHHTRVFS NSYVLQAGMR IVSNRRRALM VLGKDSSGKH DLLLPASTTA YLAEQGYAGL       120
     TGCIESVGAV IQSLGLKPPK MPDPINLFMH VTLHQDGRIE PLPNTTRAGD FVACRVVTDM       180
     VFIVSACCTG IPGNDVPGAL ELSAAEELDQ L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page