(data stored in ACNUC7421 zone)

EMBL: CP000271.PE37

CP000271.PE37        Location/Qualifiers
FT   CDS             39594..39851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD4"
FT                   /protein_id="ABE33005.1"
FT                   /translation="MTQDVTPKPPTGDRPELEHLDAALSHVDQQVSSGSIASGAAKGIL
FT                   YSLIETLGTFVGDPDLPEHARSGYEGLLEAARELRAKLDH"
     MTQDVTPKPP TGDRPELEHL DAALSHVDQQ VSSGSIASGA AKGILYSLIE TLGTFVGDPD        60
     LPEHARSGYE GLLEAARELR AKLDH                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page