(data stored in ACNUC7421 zone)

EMBL: CP000271.PE370

CP000271.PE370       Location/Qualifiers
FT   CDS             424306..424989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2655"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33338"
FT                   /db_xref="GOA:Q13RF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF1"
FT                   /protein_id="ABE33338.1"
FT                   /translation="MGFDPQVIHSLPTLIDGWLLTVELTLLGATGSLVFGHLALAMQLT
FT                   RIAPLRWAARLYISFMRGTPALVQLFVLFFALPLIGLGGRPMLAAALTLGLNSGAYTAE
FT                   ILRGNLRVITPGQYEAAIALGMAPSRIALRIAMPQMLKASLPALINEFTILLKTTPLAS
FT                   VVAVTELTYAGQMVIARTYTSAQVMLLVSVGYLAVALPVIYAARRAQRSPRMPGAGRVA
FT                   PGVAR"
     MGFDPQVIHS LPTLIDGWLL TVELTLLGAT GSLVFGHLAL AMQLTRIAPL RWAARLYISF        60
     MRGTPALVQL FVLFFALPLI GLGGRPMLAA ALTLGLNSGA YTAEILRGNL RVITPGQYEA       120
     AIALGMAPSR IALRIAMPQM LKASLPALIN EFTILLKTTP LASVVAVTEL TYAGQMVIAR       180
     TYTSAQVMLL VSVGYLAVAL PVIYAARRAQ RSPRMPGAGR VAPGVAR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page