(data stored in ACNUC7421 zone)

EMBL: CP000271.PE371

CP000271.PE371       Location/Qualifiers
FT   CDS             424986..425660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2654"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33339"
FT                   /db_xref="GOA:Q13RF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF0"
FT                   /protein_id="ABE33339.1"
FT                   /translation="MTFDLSVLSGYWPQLAAGFGSTVWLCAAGAAMSGVLGVLLTVGQR
FT                   RGGPWLAAVIRGYTALTLGLPLLVLLYVMFFVLPDFGVLLPAPLVGTVTLAIYYGPYVA
FT                   EVIGAAVAAVPAGTVEAGVAIGMSPVAIARRIVAPQALPLLLPTLTGLLIGLVKDSALL
FT                   SVISVHEFMFAAKAVVSDTYAPLEVYFVVALVYWAATSVVHFSTRHWERRLGRVHRVSL
FT                   PR"
     MTFDLSVLSG YWPQLAAGFG STVWLCAAGA AMSGVLGVLL TVGQRRGGPW LAAVIRGYTA        60
     LTLGLPLLVL LYVMFFVLPD FGVLLPAPLV GTVTLAIYYG PYVAEVIGAA VAAVPAGTVE       120
     AGVAIGMSPV AIARRIVAPQ ALPLLLPTLT GLLIGLVKDS ALLSVISVHE FMFAAKAVVS       180
     DTYAPLEVYF VVALVYWAAT SVVHFSTRHW ERRLGRVHRV SLPR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page