(data stored in ACNUC7421 zone)

EMBL: CP000271.PE376

CP000271.PE376       Location/Qualifiers
FT   CDS             428973..430103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2649"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33344"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE5"
FT                   /protein_id="ABE33344.1"
FT                   /translation="MTSLPAFVSRVLGVTAAQRGRALSSHSPQHDGERFRNVKPRPAEG
FT                   LRKTLGIVWNVLFNKPRGTVPTAALPIETLTRSQLDAAPDRSLYRLGHSTMLLKLRGQF
FT                   WLTDPVFAERASPFRHFGPKRFHAPPIALADLPPLRGVILSHDHYDHLDRETVLLLAQT
FT                   TGVFLTPLGVGDRLIEWGIDASKVRQFDWWQGTEVDGMQFTATPAQHFSGRSLFDGNST
FT                   LWASWVIVDDDLRVFFSGDTGYFDGFKTIGERLGPFDVTLVETGAYNEQWPYVHMQPEE
FT                   TVQAHIDLRGQWLVPIHNGTFDLAMHHWQEPFERVMGLALVHGVALSTPGMGERLDLSA
FT                   PHRGERWWRHAVEPAAAPKAAWRLCASRNVGDAKSS"
     MTSLPAFVSR VLGVTAAQRG RALSSHSPQH DGERFRNVKP RPAEGLRKTL GIVWNVLFNK        60
     PRGTVPTAAL PIETLTRSQL DAAPDRSLYR LGHSTMLLKL RGQFWLTDPV FAERASPFRH       120
     FGPKRFHAPP IALADLPPLR GVILSHDHYD HLDRETVLLL AQTTGVFLTP LGVGDRLIEW       180
     GIDASKVRQF DWWQGTEVDG MQFTATPAQH FSGRSLFDGN STLWASWVIV DDDLRVFFSG       240
     DTGYFDGFKT IGERLGPFDV TLVETGAYNE QWPYVHMQPE ETVQAHIDLR GQWLVPIHNG       300
     TFDLAMHHWQ EPFERVMGLA LVHGVALSTP GMGERLDLSA PHRGERWWRH AVEPAAAPKA       360
     AWRLCASRNV GDAKSS                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page