(data stored in ACNUC7421 zone)

EMBL: CP000271.PE377

CP000271.PE377       Location/Qualifiers
FT   CDS             complement(430260..430655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33345"
FT                   /db_xref="GOA:Q13RE4"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE4"
FT                   /protein_id="ABE33345.1"
FT                   /translation="MQDAAASAHHASLSAMVKAVVAAFVKAKTQNLDESRALYAVALEL
FT                   DSRSYVREVEARNRAALEAMLKTASDADFDDVPMTTFMFMGAMVGPIRLLLEAKSPQSM
FT                   IRKFRVQLESLCLGYLEREAYPKRSTD"
     MQDAAASAHH ASLSAMVKAV VAAFVKAKTQ NLDESRALYA VALELDSRSY VREVEARNRA        60
     ALEAMLKTAS DADFDDVPMT TFMFMGAMVG PIRLLLEAKS PQSMIRKFRV QLESLCLGYL       120
     EREAYPKRST D                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page