(data stored in ACNUC7421 zone)

EMBL: CP000271.PE38

CP000271.PE38        Location/Qualifiers
FT   CDS             40072..40671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2990"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33006"
FT                   /db_xref="GOA:Q13SD3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD3"
FT                   /protein_id="ABE33006.1"
FT                   /translation="MLSVSAIALLAFGIVVVLITPGPTNTLLAAAGLRQGVRRSLRLIA
FT                   AELGGYVISISVWGHFLVKAAHALPWLPSLVRVAAGLYIAYLAVDMWRAAVALSDSAQQ
FT                   ASGMRTLFVATLLNPKGLLFAGTIFPAIAFAQLPAYAFAMLMLACLLVPIALAWITFGA
FT                   ALGSGKLTWLNPVKMQRGASIVLGVFSLSLAWAALH"
     MLSVSAIALL AFGIVVVLIT PGPTNTLLAA AGLRQGVRRS LRLIAAELGG YVISISVWGH        60
     FLVKAAHALP WLPSLVRVAA GLYIAYLAVD MWRAAVALSD SAQQASGMRT LFVATLLNPK       120
     GLLFAGTIFP AIAFAQLPAY AFAMLMLACL LVPIALAWIT FGAALGSGKL TWLNPVKMQR       180
     GASIVLGVFS LSLAWAALH                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page