(data stored in ACNUC7421 zone)

EMBL: CP000271.PE382

CP000271.PE382       Location/Qualifiers
FT   CDS             complement(433967..435898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2643"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33350"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD9"
FT                   /protein_id="ABE33350.1"
FT                   /translation="MGQRSLLLPGWIKAALSANDRLKLYLSVLQVAFAHAEHPDGELPD
FT                   LTAELVAAHVDAPWLRDMPASASLMDGTLLLPDLTRLVQRLAEDLETMARPLLQPDEPA
FT                   NALHARVQHWLDELGTLRGERLDRPQLQSLTRGQRTNGDDSLHLLVMDLHHALNQLAGT
FT                   ISSEEIDGAHVWQLQPDDRARVVAFMRGLNRTAPLKFDHPGLDTAATRDGERLLVQNDI
FT                   GTNDVHVLVVQIEGLTITLSYSDLHRPRFAFFQSLLVPYGAKWSDLQSKVNAALNEGDA
FT                   YTFGVARFDCADERALETTLEGIGSRIVFLIDWNRARKRLLSFVDKDHAIEVLREAVRL
FT                   EAGHMAWLKAGGEELIYAAMQAVGQGAFRIGDRLDTVLGATDAQAFMVEVLQMASHALL
FT                   GGQPVALVADQTRLLLARRVHQHSSAFELLEEHAGYCHALAQAVSDGLTHDIMSAPPAG
FT                   ESPTQALAARAKAWERRADHLVMRAREQAQRQPRWQPFKHLLELSDDIADALEDAAFLM
FT                   SLIADGHQQGWDRNVHESLSRLAQTVLMATQEHVKSLAIARCLGSASDTIDSDAFLAAS
FT                   WNVLRSERQCDELLRAARRAILAVVRDAAALMLANDLANTLELASDRLLVAGYALRDVA
FT                   FGETGANT"
     MGQRSLLLPG WIKAALSAND RLKLYLSVLQ VAFAHAEHPD GELPDLTAEL VAAHVDAPWL        60
     RDMPASASLM DGTLLLPDLT RLVQRLAEDL ETMARPLLQP DEPANALHAR VQHWLDELGT       120
     LRGERLDRPQ LQSLTRGQRT NGDDSLHLLV MDLHHALNQL AGTISSEEID GAHVWQLQPD       180
     DRARVVAFMR GLNRTAPLKF DHPGLDTAAT RDGERLLVQN DIGTNDVHVL VVQIEGLTIT       240
     LSYSDLHRPR FAFFQSLLVP YGAKWSDLQS KVNAALNEGD AYTFGVARFD CADERALETT       300
     LEGIGSRIVF LIDWNRARKR LLSFVDKDHA IEVLREAVRL EAGHMAWLKA GGEELIYAAM       360
     QAVGQGAFRI GDRLDTVLGA TDAQAFMVEV LQMASHALLG GQPVALVADQ TRLLLARRVH       420
     QHSSAFELLE EHAGYCHALA QAVSDGLTHD IMSAPPAGES PTQALAARAK AWERRADHLV       480
     MRAREQAQRQ PRWQPFKHLL ELSDDIADAL EDAAFLMSLI ADGHQQGWDR NVHESLSRLA       540
     QTVLMATQEH VKSLAIARCL GSASDTIDSD AFLAASWNVL RSERQCDELL RAARRAILAV       600
     VRDAAALMLA NDLANTLELA SDRLLVAGYA LRDVAFGETG ANT                         643
//

If you have problems or comments...

PBIL Back to PBIL home page