(data stored in ACNUC7421 zone)

EMBL: CP000271.PE387

CP000271.PE387       Location/Qualifiers
FT   CDS             443000..443839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2638"
FT                   /product="ABC sulfonate transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2638"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33355"
FT                   /db_xref="GOA:Q13RD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD4"
FT                   /protein_id="ABE33355.1"
FT                   /translation="MADVTYSRDSYVASTRSYLGLSKSAFYRWLSWIVPAVVVVLWQIA
FT                   SRVGLIAPQVLPAPSSVLTTALDLATHGDLFVHLGVSLLRAAAGFAIGGTIGLALGVLV
FT                   GFSPLAQALLDRSIQMVRAIPFLAMLPLVIVWFGVGEVAKIFLVALAVLFPIYINTMLG
FT                   IRQIDPKLMELAKVVGLDWPAVVRRIILPGAMPSILTGVRYALAHAWLALVIAETLATT
FT                   KGIGFLAMDAREFLQTNVILLTIIIYAIIGVVADALVRLLEAHFLTWHANYAKGARK"
     MADVTYSRDS YVASTRSYLG LSKSAFYRWL SWIVPAVVVV LWQIASRVGL IAPQVLPAPS        60
     SVLTTALDLA THGDLFVHLG VSLLRAAAGF AIGGTIGLAL GVLVGFSPLA QALLDRSIQM       120
     VRAIPFLAML PLVIVWFGVG EVAKIFLVAL AVLFPIYINT MLGIRQIDPK LMELAKVVGL       180
     DWPAVVRRII LPGAMPSILT GVRYALAHAW LALVIAETLA TTKGIGFLAM DAREFLQTNV       240
     ILLTIIIYAI IGVVADALVR LLEAHFLTWH ANYAKGARK                              279
//

If you have problems or comments...

PBIL Back to PBIL home page