(data stored in ACNUC7421 zone)

EMBL: CP000271.PE388

CP000271.PE388       Location/Qualifiers
FT   CDS             443836..444579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2637"
FT                   /product="ABC sulfonate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33356"
FT                   /db_xref="GOA:Q13RD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RD3"
FT                   /protein_id="ABE33356.1"
FT                   /translation="MSIDFALPQDAAIPAAAEERVNRTPLAVSVRGLQRRYGARVVIDA
FT                   LDLDIREGEFVTLLGESGCGKTTLLRALAGLDQPDAGQIRAPERPSVVFQEHRLLPWAT
FT                   LWENVVLGHETTIGRVGATRALAEVGLSGREDDWPRNLSGGQAQRVALARGLVRDPALL
FT                   LLDEPFAALDALTRIKMHGLVKELVARHHPGVLLVTHDVDEALTLADRILVMRSGRIAA
FT                   SFHPKNHTPQALRPILLEELGVQSH"
     MSIDFALPQD AAIPAAAEER VNRTPLAVSV RGLQRRYGAR VVIDALDLDI REGEFVTLLG        60
     ESGCGKTTLL RALAGLDQPD AGQIRAPERP SVVFQEHRLL PWATLWENVV LGHETTIGRV       120
     GATRALAEVG LSGREDDWPR NLSGGQAQRV ALARGLVRDP ALLLLDEPFA ALDALTRIKM       180
     HGLVKELVAR HHPGVLLVTH DVDEALTLAD RILVMRSGRI AASFHPKNHT PQALRPILLE       240
     ELGVQSH                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page