(data stored in ACNUC7421 zone)

EMBL: CP000271.PE389

CP000271.PE389       Location/Qualifiers
FT   CDS             444616..445620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2636"
FT                   /product="ABC sulfonate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33357"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD2"
FT                   /protein_id="ABE33357.1"
FT                   /translation="MNDSSLSRRQLLRAAGGLLAGAAASSLFPVRAAEPRKLTRNTDTV
FT                   RVGWGYGSLPDIARQRGVFEKTLAAKGIEVEWVGPFPNHAPSIQAVVGGSADFGFWGST
FT                   TPALAAMLAGSPLVFNAFDIYSPRSTAIIVKKTSGINSVADLVGRKVAINRSGLGEFLL
FT                   IAALEKNHIDRSKVEFVYLNPPDAAPAFAQGVVDAWSMWSPAVDIARYSNNAKDIFNEG
FT                   RDLDFLIDYSSLVTRRKFTEENSELIRAVIDAYYVEGAWQSAHSAESEQLVQREAKYPD
FT                   QVRDYLTSLKRVNQFHEPDDAAFIAQFQRAADWLAERKIINSRIKVADYSVKV"
     MNDSSLSRRQ LLRAAGGLLA GAAASSLFPV RAAEPRKLTR NTDTVRVGWG YGSLPDIARQ        60
     RGVFEKTLAA KGIEVEWVGP FPNHAPSIQA VVGGSADFGF WGSTTPALAA MLAGSPLVFN       120
     AFDIYSPRST AIIVKKTSGI NSVADLVGRK VAINRSGLGE FLLIAALEKN HIDRSKVEFV       180
     YLNPPDAAPA FAQGVVDAWS MWSPAVDIAR YSNNAKDIFN EGRDLDFLID YSSLVTRRKF       240
     TEENSELIRA VIDAYYVEGA WQSAHSAESE QLVQREAKYP DQVRDYLTSL KRVNQFHEPD       300
     DAAFIAQFQR AADWLAERKI INSRIKVADY SVKV                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page