(data stored in SCRATCH zone)

EMBL: CP000271.PE39

CP000271.PE39        Location/Qualifiers
FT   CDS             complement(40692..41942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2989"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33007"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD2"
FT                   /protein_id="ABE33007.1"
FT                   /translation="MKTLSLSAARTLHLAAQGLLTPPRRKAVKADVLDAIRRMAQLQID
FT                   TIHVVARSPYLVLFSRLGAYPQQWLDEHLAEGKLFEYWSHEACFVPTEDYGLLRHRMLD
FT                   PSGMGWKYAAEWHKKHRKDIEKLLAHIRATGPVRSADFAREAGKGNGWWDWKPEKRHLE
FT                   VLFAIGQLMVAERRNFHRVYDLTERVLPDWDDARDLPPAHTVTEEVLRRTCRALGVARA
FT                   DWVADYYRLPRRPYRDELHALADQGELIPVRVEGWKQDTFVHRDFAPILDDAASGKLTS
FT                   TVTTVLSPFDPVVWDRKRAAALFDFDYAIECYTPAAKRKYGYFVLPLLSRGRLVGRVDA
FT                   KAHRTQGVFELKSLHIEPGVRLSARLAGDLRRALQRCADWHGTPQLEITAAPPEWLDAL
FT                   SVEDVSNEVRLRAGVAA"
     MKTLSLSAAR TLHLAAQGLL TPPRRKAVKA DVLDAIRRMA QLQIDTIHVV ARSPYLVLFS        60
     RLGAYPQQWL DEHLAEGKLF EYWSHEACFV PTEDYGLLRH RMLDPSGMGW KYAAEWHKKH       120
     RKDIEKLLAH IRATGPVRSA DFAREAGKGN GWWDWKPEKR HLEVLFAIGQ LMVAERRNFH       180
     RVYDLTERVL PDWDDARDLP PAHTVTEEVL RRTCRALGVA RADWVADYYR LPRRPYRDEL       240
     HALADQGELI PVRVEGWKQD TFVHRDFAPI LDDAASGKLT STVTTVLSPF DPVVWDRKRA       300
     AALFDFDYAI ECYTPAAKRK YGYFVLPLLS RGRLVGRVDA KAHRTQGVFE LKSLHIEPGV       360
     RLSARLAGDL RRALQRCADW HGTPQLEITA APPEWLDALS VEDVSNEVRL RAGVAA           416
//

If you have problems or comments...

PBIL Back to PBIL home page