(data stored in ACNUC7421 zone)

EMBL: CP000271.PE394

CP000271.PE394       Location/Qualifiers
FT   CDS             451060..451521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC7"
FT                   /protein_id="ABE33362.1"
FT                   /translation="MSKTAKNQPASRPPVDALQYEKLALSAFDLCERQLGKLNTLITLA
FT                   SSMCRNPAVTSDERRRRQTMLELLVDTAEQYHQDLECERELFQVIALDAKGVPQARLTA
FT                   SHATRLLVEASRIANGSQATDNAPKRKRSPAKSVAIAKAHAQQSVAVQH"
     MSKTAKNQPA SRPPVDALQY EKLALSAFDL CERQLGKLNT LITLASSMCR NPAVTSDERR        60
     RRQTMLELLV DTAEQYHQDL ECERELFQVI ALDAKGVPQA RLTASHATRL LVEASRIANG       120
     SQATDNAPKR KRSPAKSVAI AKAHAQQSVA VQH                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page