(data stored in ACNUC7421 zone)

EMBL: CP000271.PE396

CP000271.PE396       Location/Qualifiers
FT   CDS             452936..453286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33364"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC5"
FT                   /protein_id="ABE33364.1"
FT                   /translation="MRDLWCLCVQSVDDCCLTLFDAWCERRAVIPLCYLLNVWPIVSAS
FT                   GSAICRLYAILDEILSNEAEGLMDRERKIINTILRNKCTLVEGLPAGVANAVCDVCSNR
FT                   RYEVTLFDGGVV"
     MRDLWCLCVQ SVDDCCLTLF DAWCERRAVI PLCYLLNVWP IVSASGSAIC RLYAILDEIL        60
     SNEAEGLMDR ERKIINTILR NKCTLVEGLP AGVANAVCDV CSNRRYEVTL FDGGVV           116
//

If you have problems or comments...

PBIL Back to PBIL home page