(data stored in ACNUC7421 zone)

EMBL: CP000271.PE399

CP000271.PE399       Location/Qualifiers
FT   CDS             457587..459362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2626"
FT                   /product="periplasmic sensor diguanylate cyclase (GGDEF
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33367"
FT                   /db_xref="GOA:Q13RC2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC2"
FT                   /protein_id="ABE33367.1"
FT                   /translation="MIRKAFSAMSIDRRFGISVAAALLPVLLLCGRLVVHEWHAYMVAD
FT                   DALYAFQTYRAGLLAIESVSAERGPTNSVLGENLPIPEARRASLLRARGESDARIEKLL
FT                   EMLQSSRCPGCATELARIENARAELTGARANVDQLIGLPLAQRRERALSSAVDRMIKVI
FT                   PQFSPVIDALAANVVRGDTRALNCLILATLTADLREAAGQLGSHFTAALTARRALGEGD
FT                   QLAIERTEGRIDQLRELIDSHIRDRSMLESAPFDRMNRQYFGEGMAYITDVRSLATRPG
FT                   GVAISPAQLADHYVPMMRPITAFRDQVLDLADTEIRFHRSNALGLLAVSALAAFLLIMI
FT                   LLSMAMLFRRRVIRPLVDATHVIGAIANGDLTAEIPAARYRGEIKAMFNAIGVLKANSV
FT                   ERQQLERERGRLIQELKATAETDFLTHLLNRRAFESRARLSCAERNAAEPELALIMFDI
FT                   DHFKKINDTYGHATGDHALQLVARLCRETCRQADVVARWGGEEFAVLSRVQDAAQALAV
FT                   AERLRCRIRETRIPVSGGDGFNITASFGVAFASACDSRDVDRLFRRADRLLYQAKEAGR
FT                   DRIFADPTSVASDNA"
     MIRKAFSAMS IDRRFGISVA AALLPVLLLC GRLVVHEWHA YMVADDALYA FQTYRAGLLA        60
     IESVSAERGP TNSVLGENLP IPEARRASLL RARGESDARI EKLLEMLQSS RCPGCATELA       120
     RIENARAELT GARANVDQLI GLPLAQRRER ALSSAVDRMI KVIPQFSPVI DALAANVVRG       180
     DTRALNCLIL ATLTADLREA AGQLGSHFTA ALTARRALGE GDQLAIERTE GRIDQLRELI       240
     DSHIRDRSML ESAPFDRMNR QYFGEGMAYI TDVRSLATRP GGVAISPAQL ADHYVPMMRP       300
     ITAFRDQVLD LADTEIRFHR SNALGLLAVS ALAAFLLIMI LLSMAMLFRR RVIRPLVDAT       360
     HVIGAIANGD LTAEIPAARY RGEIKAMFNA IGVLKANSVE RQQLERERGR LIQELKATAE       420
     TDFLTHLLNR RAFESRARLS CAERNAAEPE LALIMFDIDH FKKINDTYGH ATGDHALQLV       480
     ARLCRETCRQ ADVVARWGGE EFAVLSRVQD AAQALAVAER LRCRIRETRI PVSGGDGFNI       540
     TASFGVAFAS ACDSRDVDRL FRRADRLLYQ AKEAGRDRIF ADPTSVASDN A                591
//

If you have problems or comments...

PBIL Back to PBIL home page