(data stored in ACNUC7421 zone)

EMBL: CP000271.PE4

CP000271.PE4         Location/Qualifiers
FT   CDS             5826..6899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32972"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG7"
FT                   /protein_id="ABE32972.1"
FT                   /translation="MATVRDLTQTGSASDIPKDIDHFWERIRNVSRVKVGTGAIPKALE
FT                   ERAGELLGALFEEAVTHARATLDDEREEMRTQIAAADQRARDAEIRQQAAEDAIKRGEL
FT                   RAEAGWERVRALEAQLSSATTHGNTHQEGLQATVRRLDQENESLRQRLDTEFATNAALR
FT                   DRIDALHVELRQSTEHYAQQIKDAIAEAERRVKPMLVELDSLRSMAATYQSGLRDASRK
FT                   EFEFIQQIAAAKARGDRLDAQLREQSDEVDALTKEVAVLRSQQGVDPAIATLLCSLVEA
FT                   GRLTEDELKAIGTAVDGHVALPLRCPKCEEGEPELSQVDHRFELQCPECDHSSGLGESR
FT                   LEAVRRFQSSGPVAASA"
     MATVRDLTQT GSASDIPKDI DHFWERIRNV SRVKVGTGAI PKALEERAGE LLGALFEEAV        60
     THARATLDDE REEMRTQIAA ADQRARDAEI RQQAAEDAIK RGELRAEAGW ERVRALEAQL       120
     SSATTHGNTH QEGLQATVRR LDQENESLRQ RLDTEFATNA ALRDRIDALH VELRQSTEHY       180
     AQQIKDAIAE AERRVKPMLV ELDSLRSMAA TYQSGLRDAS RKEFEFIQQI AAAKARGDRL       240
     DAQLREQSDE VDALTKEVAV LRSQQGVDPA IATLLCSLVE AGRLTEDELK AIGTAVDGHV       300
     ALPLRCPKCE EGEPELSQVD HRFELQCPEC DHSSGLGESR LEAVRRFQSS GPVAASA          357
//

If you have problems or comments...

PBIL Back to PBIL home page