(data stored in SCRATCH zone)

EMBL: CP000271.PE40

CP000271.PE40        Location/Qualifiers
FT   CDS             complement(42064..42354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2988"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD1"
FT                   /protein_id="ABE33008.1"
FT                   /translation="MFQRATLLAAIGLAAACASTAASARVDVGVFVNTPGPVYAAPPVY
FT                   AAPPVYAPPPVVYAPRPAYGYGYRDDYYRGRRWHHDHGRHRGWDRHHGRGW"
     MFQRATLLAA IGLAAACAST AASARVDVGV FVNTPGPVYA APPVYAAPPV YAPPPVVYAP        60
     RPAYGYGYRD DYYRGRRWHH DHGRHRGWDR HHGRGW                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page