(data stored in ACNUC7421 zone)

EMBL: CP000271.PE400

CP000271.PE400       Location/Qualifiers
FT   CDS             complement(459421..459723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2625"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33368"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC1"
FT                   /protein_id="ABE33368.1"
FT                   /translation="MKSLIKAATLVVVLAVPLASFAQSEQPVTRAEVKAQLKQLEQAGY
FT                   NPAVATDAVYPADIQAAEARVSARNNAATAYGPSTAGSSETGSGVPAGNPNLQGQ"
     MKSLIKAATL VVVLAVPLAS FAQSEQPVTR AEVKAQLKQL EQAGYNPAVA TDAVYPADIQ        60
     AAEARVSARN NAATAYGPST AGSSETGSGV PAGNPNLQGQ                             100
//

If you have problems or comments...

PBIL Back to PBIL home page